General Information

  • ID:  hor006329
  • Uniprot ID:  Q9ESQ8
  • Protein name:  Neuropeptide NPSF
  • Gene name:  Npvf
  • Organism:  Mus musculus (Mouse)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0032277 negative regulation of gonadotropin secretion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SVSFQELKDWGAKNVIKMSPAPANKVPHSAANLPLRF
  • Length:  37
  • Propeptide:  MEIISLKRFILLTVATSSFLTSNTFCTDEFMMPHFHSKEGDGKYSQLRGIPKGEKERSVSFQELKDWGAKNVIKMSPAPANKVPHSAANLPLRFGRTIDEKRSPAARVNMEAGTRSHFPSLPQRFGRTTARSPKTPADLPQKPLHSLGSSELLYVMICQHQEIQSPGGKRTRRGAFVETDDAERKPEK
  • Signal peptide:  MEIISLKRFILLTVATSSFLTSNTFC
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide RFRP-1 acts as a potent negative regulator of gonadotropin synthesis and secretion. Neuropeptides NPSF and NPVF efficiently inhibit forskolin-induced production of cAMP. Neuropeptide NPVF blocks morphine-induced analgesia (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9ESQ8-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006329_AF2.pdbhor006329_ESM.pdb

Physical Information

Mass: 469201 Formula: C184H291N51O50S
Absent amino acids: CTY Common amino acids: A
pI: 10.79 Basic residues: 6
Polar residues: 8 Hydrophobic residues: 15
Hydrophobicity: -27.57 Boman Index: -4394
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 79.19
Instability Index: 7314.86 Extinction Coefficient cystines: 5500
Absorbance 280nm: 152.78

Literature

  • PubMed ID:  11025660
  • Title:  New neuropeptides containing carboxy-terminal RFamide and their receptor in mammals.
  • PubMed ID:  11481330
  • Title:  Identification and characterization of novel mammalian neuropeptide FF-like peptides that attenuate morphine-induced antinociception.